GRSF1 anticorps (Middle Region)

N° du produit ABIN633346

Cet anticorps Lapin Polyclonal détecte spécifiquement GRSF1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour GRSF1 anticorps (Middle Region) (ABIN633346)

Antigène: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRSF1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GRSF1 anticorps

Épitope: Middle Region

Specificité: GRSF1 antibody was raised against the middle region of GRSF1

Purification: Affinity purified

Immunogène: GRSF1 antibody was raised using the middle region of GRSF1 corresponding to a region with amino acids IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRSF1 Blocking Peptide, (ABIN939525), is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRSF1

Antigène: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Autre désignation: GRSF1

Sujet: GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.

Poids moléculaire: 53 kDa (MW of target protein)