CELF4 anticorps

N° du produit ABIN633349

Cet anticorps Lapin Polyclonal détecte spécifiquement CELF4 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour CELF4 anticorps (ABIN633349)

Antigène: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CELF4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CELF4 anticorps

Purification: Affinity purified

Immunogène: BRUNOL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BRUNOL4 Blocking Peptide, (ABIN5612366), is also available for use as a blocking control in assays to test for specificity of this BRUNOL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CELF4

Antigène: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Autre désignation: BRUNOL4

Sujet: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Synaptic Membrane