RBM22 anticorps (C-Term)

N° du produit ABIN633355

Cet anticorps Lapin Polyclonal détecte spécifiquement RBM22 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour RBM22 anticorps (C-Term) (ABIN633355)

Antigène: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM22 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RBM22 anticorps

Épitope: C-Term

Specificité: RBM22 antibody was raised against the C terminal of RBM22

Purification: Affinity purified

Immunogène: RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM22 Blocking Peptide, (ABIN940116), is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM22

Antigène: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Autre désignation: RBM22

Sujet: RBM22 may be involved in pre-mRNA splicing.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus