A2BP1 anticorps (Middle Region)
-
- Antigène Voir toutes A2BP1 Anticorps
- A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp A2BP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- A2 BP1 antibody was raised against the middle region of A2 P1
- Purification
- Affinity purified
- Immunogène
- A2 BP1 antibody was raised using the middle region of A2 P1 corresponding to a region with amino acids TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP
- Top Product
- Discover our top product A2BP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
A2BP1 Blocking Peptide, catalog no. 33R-8963, is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 P1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))
- Autre désignation
- A2BP1 (A2BP1 Produits)
- Synonymes
- anticorps A2BP1, anticorps fox1, anticorps a2bp1, anticorps zgc:103635, anticorps 2BP1, anticorps FOX-1, anticorps FOX1, anticorps HRNBP1, anticorps A2bp, anticorps A2bp1, anticorps Hrnbp1, anticorps fox-1, anticorps RNA binding protein, fox-1 homolog 1, anticorps RNA binding fox-1 homolog 1, anticorps multicopper ferroxidase, anticorps RNA binding protein, fox-1 homolog (C. elegans) 1, anticorps RBFOX1, anticorps rbfox1, anticorps FOX1, anticorps Rbfox1
- Sujet
- Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2).
- Poids moléculaire
- 42 kDa (MW of target protein)
-