A2BP1 anticorps (Middle Region)

N° du produit ABIN633356

L’anticorps anti-A2BP1 Polyclonal Lapin est utilisé pour la détection de A2BP1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour A2BP1 anticorps (Middle Region) (ABIN633356)

Antigène: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp A2BP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-A2BP1 anticorps

Épitope: Middle Region

Specificité: A2 BP1 antibody was raised against the middle region of A2 P1

Purification: Affinity purified

Immunogène: A2 BP1 antibody was raised using the middle region of A2 P1 corresponding to a region with amino acids TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

A2BP1 Blocking Peptide, (ABIN5611837), is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur A2BP1

Antigène: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Autre désignation: A2BP1

Sujet: Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2).

Poids moléculaire: 42 kDa (MW of target protein)