IFIH1 anticorps (Middle Region)

N° du produit ABIN633360

Cet anticorps anti-IFIH1 Polyclonal Lapin (ABIN633360) détecte spécifiquement IFIH1 dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour IFIH1 anticorps (Middle Region) (ABIN633360)

Antigène: IFIH1 (Interferon Induced with Helicase C Domain 1 (IFIH1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFIH1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-IFIH1 anticorps

Épitope: Middle Region

Specificité: IFIH1 antibody was raised against the middle region of IFIH1

Purification: Affinity purified

Immunogène: IFIH1 antibody was raised using the middle region of IFIH1 corresponding to a region with amino acids QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFIH1 Blocking Peptide, (ABIN5614142), is also available for use as a blocking control in assays to test for specificity of this IFIH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFIH1

Antigène: IFIH1 (Interferon Induced with Helicase C Domain 1 (IFIH1))

Autre désignation: IFIH1

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. IFIH1 is a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents, treatment with either agent alone only achieves reversible differentiation.

Poids moléculaire: 117 kDa (MW of target protein)

Pathways: Activation of Innate immune Response