DHX8 anticorps

N° du produit ABIN633364

Cet anticorps Lapin Polyclonal détecte spécifiquement DHX8 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour DHX8 anticorps (ABIN633364)

Antigène: DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8 (DHX8))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DHX8 anticorps

Purification: Affinity purified

Immunogène: DHX8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX8 Blocking Peptide, (ABIN5613199), is also available for use as a blocking control in assays to test for specificity of this DHX8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX8

Antigène: DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8 (DHX8))

Autre désignation: DHX8

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Poids moléculaire: 139 kDa (MW of target protein)