DDX25 anticorps

N° du produit ABIN633365

L’anticorps Lapin Polyclonal anti-DDX25 a été validé pour WB. Il convient pour détecter DDX25 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour DDX25 anticorps (ABIN633365)

Antigène: DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX25 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DDX25 anticorps

Purification: Affinity purified

Immunogène: DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX25 Blocking Peptide, (ABIN5613158), is also available for use as a blocking control in assays to test for specificity of this DDX25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX25

Antigène: DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))

Autre désignation: DDX25

Sujet: DDX25 is a member of DEAD box proteins family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Poids moléculaire: 41 kDa (MW of target protein)