DHX32 anticorps

N° du produit ABIN633369

Cet anticorps anti-DHX32 est un anticorps Lapin Polyclonal détectant DHX32 dans WB. Adapté pour Humain.

Aperçu rapide pour DHX32 anticorps (ABIN633369)

Antigène: DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX32 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DHX32 anticorps

Purification: Affinity purified

Immunogène: DHX32 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX32 Blocking Peptide, (ABIN937733), is also available for use as a blocking control in assays to test for specificity of this DHX32 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX32

Antigène: DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))

Autre désignation: DHX32

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.

Poids moléculaire: 84 kDa (MW of target protein)