ENOX1 anticorps (Middle Region)

N° du produit ABIN633381

Cet anticorps anti-ENOX1 est un anticorps Lapin Polyclonal détectant ENOX1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ENOX1 anticorps (Middle Region) (ABIN633381)

Antigène: ENOX1 (Ecto-NOX Disulfide-Thiol Exchanger 1 (ENOX1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ENOX1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ENOX1 anticorps

Épitope: Middle Region

Specificité: ENOX1 antibody was raised against the middle region of ENOX1

Purification: Affinity purified

Immunogène: ENOX1 antibody was raised using the middle region of ENOX1 corresponding to a region with amino acids QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENOX1 Blocking Peptide, (ABIN5613378), is also available for use as a blocking control in assays to test for specificity of this ENOX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ENOX1

Antigène: ENOX1 (Ecto-NOX Disulfide-Thiol Exchanger 1 (ENOX1))

Autre désignation: ENOX1

Sujet: Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant. Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival. Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways. These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes.

Poids moléculaire: 73 kDa (MW of target protein)