ENOX1 anticorps (Middle Region)

N° du produit ABIN633381

Détail du produit anti-ENOX1 anticorps

Antigène: ENOX1 (Ecto-NOX Disulfide-Thiol Exchanger 1 (ENOX1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ENOX1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ENOX1 antibody was raised against the middle region of ENOX1

Purification: Affinity purified

Immunogène: ENOX1 antibody was raised using the middle region of ENOX1 corresponding to a region with amino acids QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENOX1 Blocking Peptide, catalog no. 33R-7696, is also available for use as a blocking control in assays to test for specificity of this ENOX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ENOX1

Antigène: ENOX1 (Ecto-NOX Disulfide-Thiol Exchanger 1 (ENOX1))

Autre désignation: ENOX1 (ENOX1 Produits)

Synonymes: anticorps CNOX, anticorps PIG38, anticorps bA64J21.1, anticorps cCNOX, anticorps B230207J08, anticorps D230005D02Rik, anticorps RGD1306118, anticorps ecto-NOX disulfide-thiol exchanger 1 S homeolog, anticorps ecto-NOX disulfide-thiol exchanger 1, anticorps enox1.S, anticorps ENOX1, anticorps Enox1

Sujet: Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant. Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival. Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways. These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes.

Poids moléculaire: 73 kDa (MW of target protein)