RBM4 anticorps (Middle Region)

N° du produit ABIN633396

Cet anticorps anti-RBM4 est un anticorps Lapin Polyclonal détectant RBM4 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour RBM4 anticorps (Middle Region) (ABIN633396)

Antigène: RBM4 (RNA Binding Motif Protein 4 (RBM4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RBM4 anticorps

Épitope: Middle Region

Specificité: RBM4 antibody was raised against the middle region of RBM4

Purification: Affinity purified

Immunogène: RBM4 antibody was raised using the middle region of RBM4 corresponding to a region with amino acids TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM4 Blocking Peptide, (ABIN5615793), is also available for use as a blocking control in assays to test for specificity of this RBM4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM4

Antigène: RBM4 (RNA Binding Motif Protein 4 (RBM4))

Autre désignation: RBM4

Sujet: RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Photoperiodism