RBM4 anticorps (Middle Region)

N° du produit ABIN633396

Détail du produit anti-RBM4 anticorps

Antigène: RBM4 (RNA Binding Motif Protein 4 (RBM4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM4 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBM4 antibody was raised against the middle region of RBM4

Purification: Affinity purified

Immunogène: RBM4 antibody was raised using the middle region of RBM4 corresponding to a region with amino acids TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM4 Blocking Peptide, catalog no. 33R-8981, is also available for use as a blocking control in assays to test for specificity of this RBM4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM4

Antigène: RBM4 (RNA Binding Motif Protein 4 (RBM4))

Autre désignation: RBM4 (RBM4 Produits)

Synonymes: anticorps rbm4, anticorps rna-bp4, anticorps wu:fc31f07, anticorps wu:fc57h11, anticorps zgc:56302, anticorps LARK, anticorps RBM4A, anticorps ZCCHC21, anticorps ZCRB3A, anticorps 4921506I22Rik, anticorps Lark1, anticorps Mlark, anticorps Rbm4a, anticorps lark, anticorps Rbm4, anticorps RNA binding motif protein 4.1, anticorps RNA binding motif protein 4, anticorps RNA-binding protein 14, anticorps RNA-binding protein lark, anticorps rbm4.1, anticorps RBM4, anticorps LOC610648, anticorps Rbm4, anticorps LARK

Sujet: RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Photoperiodism