EIF2D anticorps (Middle Region)

N° du produit ABIN633404

L’anticorps anti-EIF2D Polyclonal Lapin est utilisé pour la détection de EIF2D dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour EIF2D anticorps (Middle Region) (ABIN633404)

Antigène: EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF2D est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EIF2D anticorps

Épitope: Middle Region

Specificité: Ligatin antibody was raised against the middle region of LGTN

Purification: Affinity purified

Immunogène: Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ligatin Blocking Peptide, (ABIN940111), is also available for use as a blocking control in assays to test for specificity of this Ligatin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF2D

Antigène: EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))

Autre désignation: Ligatin

Sujet: LGTN is a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively.

Poids moléculaire: 65 kDa (MW of target protein)