NOVA1 anticorps (C-Term)

N° du produit ABIN633405

Détail du produit anti-NOVA1 anticorps

Antigène: NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOVA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NOVA1 antibody was raised against the C terminal of NOVA1

Purification: Affinity purified

Immunogène: NOVA1 antibody was raised using the C terminal of NOVA1 corresponding to a region with amino acids SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOVA1 Blocking Peptide, catalog no. 33R-8555, is also available for use as a blocking control in assays to test for specificity of this NOVA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOVA1

Antigène: NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))

Autre désignation: NOVA1 (NOVA1 Produits)

Synonymes: anticorps Nova-1, anticorps NOVA1, anticorps si:ch211-222c22.9, anticorps 9430099M15Rik, anticorps G630039L02, anticorps NOVA alternative splicing regulator 1, anticorps neuro-oncological ventral antigen 1 L homeolog, anticorps neuro-oncological ventral antigen 1, anticorps RNA-binding protein Nova-1, anticorps lipid A export ATP-binding/permease protein, anticorps NOVA1, anticorps Nova1, anticorps nova1.L, anticorps nova1, anticorps LOC790874, anticorps novA1

Sujet: NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognised and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.

Poids moléculaire: 52 kDa (MW of target protein)