DAZ3 anticorps (Middle Region)

N° du produit ABIN633418

Cet anticorps Lapin Polyclonal détecte spécifiquement DAZ3 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour DAZ3 anticorps (Middle Region) (ABIN633418)

Antigène: DAZ3 (Deleted In Azoospermia 3 (DAZ3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAZ3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DAZ3 anticorps

Épitope: Middle Region

Specificité: DAZ3 antibody was raised against the middle region of DAZ3

Purification: Affinity purified

Immunogène: DAZ3 antibody was raised using the middle region of DAZ3 corresponding to a region with amino acids PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAZ3 Blocking Peptide, (ABIN5613124), is also available for use as a blocking control in assays to test for specificity of this DAZ3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAZ3

Antigène: DAZ3 (Deleted In Azoospermia 3 (DAZ3))

Autre désignation: DAZ3

Sujet: This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia.

Poids moléculaire: 49 kDa (MW of target protein)