CARS anticorps (Middle Region)

N° du produit ABIN633421

Cet anticorps Lapin Polyclonal détecte spécifiquement CARS dans WB. Il présente une réactivité avec des échantillons de Humain et Rat.

Aperçu rapide pour CARS anticorps (Middle Region) (ABIN633421)

Antigène: CARS (Cysteinyl-tRNA Synthetase (CARS))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CARS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CARS anticorps

Épitope: Middle Region

Specificité: CARS antibody was raised against the middle region of CARS

Purification: Affinity purified

Immunogène: CARS antibody was raised using the middle region of CARS corresponding to a region with amino acids QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CARS Blocking Peptide, (ABIN5612627), is also available for use as a blocking control in assays to test for specificity of this CARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CARS

Antigène: CARS (Cysteinyl-tRNA Synthetase (CARS))

Autre désignation: CARS

Sujet: CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. CARS gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Poids moléculaire: 95 kDa (MW of target protein)