RBM7 anticorps (Middle Region)

N° du produit ABIN633432

Détail du produit anti-RBM7 anticorps

Antigène: RBM7 (RNA Binding Motif Protein 7 (RBM7))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM7 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBM7 antibody was raised against the middle region of RBM7

Purification: Affinity purified

Immunogène: RBM7 antibody was raised using the middle region of RBM7 corresponding to a region with amino acids SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM7 Blocking Peptide, catalog no. 33R-8434, is also available for use as a blocking control in assays to test for specificity of this RBM7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM7

Antigène: RBM7 (RNA Binding Motif Protein 7 (RBM7))

Autre désignation: RBM7 (RBM7 Produits)

Synonymes: anticorps 1200007M24Rik, anticorps 1500011D06Rik, anticorps AU041934, anticorps AW554393, anticorps RNA binding motif protein 7, anticorps RBM7, anticorps Rbm7

Sujet: RBM7 contains 1 RRM (RNA recognition motif) domain. It is possible involved in germ cell RNA processing and meiosis.

Poids moléculaire: 30 kDa (MW of target protein)