RAD51AP1 anticorps (Middle Region)
-
- Antigène Voir toutes RAD51AP1 Anticorps
- RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAD51AP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RAD51 AP1 antibody was raised against the middle region of RAD51 P1
- Purification
- Affinity purified
- Immunogène
- RAD51 AP1 antibody was raised using the middle region of RAD51 P1 corresponding to a region with amino acids EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD
- Top Product
- Discover our top product RAD51AP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAD51AP1 Blocking Peptide, catalog no. 33R-2308, is also available for use as a blocking control in assays to test for specificity of this RAD51AP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Concentration
- Lot specific
- Buffer
- Supplied as cell culture supernatant.
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))
- Autre désignation
- RAD51AP1 (RAD51AP1 Produits)
- Synonymes
- anticorps PIR51, anticorps 2510006L10Rik, anticorps RAB22, anticorps RAD51 associated protein 1, anticorps Rad51ap1, anticorps RAD51AP1
- Sujet
- RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA.
- Poids moléculaire
- 37 kDa (MW of target protein)
-