Synaptojanin 1 anticorps (N-Term)

N° du produit ABIN633450

Cet anticorps anti-Synaptojanin 1 est un anticorps Lapin Polyclonal détectant Synaptojanin 1 dans WB. Adapté pour Humain.

Aperçu rapide pour Synaptojanin 1 anticorps (N-Term) (ABIN633450)

Antigène: Synaptojanin 1 (SYNJ1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Synaptojanin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Synaptojanin 1 anticorps

Épitope: N-Term

Specificité: Synaptojanin 1 antibody was raised against the N terminal of SYNJ1

Purification: Affinity purified

Immunogène: Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Synaptojanin 1 Blocking Peptide, (ABIN939316), is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Synaptojanin 1

Antigène: Synaptojanin 1 (SYNJ1)

Autre désignation: Synaptojanin 1

Sujet: Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.

Poids moléculaire: 143 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, Synaptic Vesicle Exocytosis