SFRS9 anticorps (Middle Region)

N° du produit ABIN633457

Cet anticorps Lapin Polyclonal détecte spécifiquement SFRS9 dans WB. Il présente une réactivité envers Humain, Souris, Rat et C. elegans.

Aperçu rapide pour SFRS9 anticorps (Middle Region) (ABIN633457)

Antigène: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Reactivité: Humain, Souris, Rat, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SFRS9 anticorps

Épitope: Middle Region

Specificité: SFRS9 antibody was raised against the middle region of SFRS9

Purification: Affinity purified

Immunogène: SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS9 Blocking Peptide, (ABIN5616107), is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS9

Antigène: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Autre désignation: SFRS9

Sujet: SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization