FAM156A anticorps (N-Term)

N° du produit ABIN633460

Cet anticorps Lapin Polyclonal détecte spécifiquement FAM156A dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour FAM156A anticorps (N-Term) (ABIN633460)

Antigène: FAM156A (Family with Sequence Similarity 156, Member A (FAM156A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM156A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM156A anticorps

Épitope: N-Term

Specificité: FAM156 A antibody was raised against the N terminal of FAM156

Purification: Affinity purified

Immunogène: FAM156 A antibody was raised using the N terminal of FAM156 corresponding to a region with amino acids DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM156A Blocking Peptide, (ABIN937492), is also available for use as a blocking control in assays to test for specificity of this FAM156A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM150 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM156A

Antigène: FAM156A (Family with Sequence Similarity 156, Member A (FAM156A))

Autre désignation: FAM156A

Sujet: The function of FAM156A protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 24 kDa (MW of target protein)