FOXRED1 anticorps (N-Term)

N° du produit ABIN633466

Détail du produit anti-FOXRED1 anticorps

Antigène: FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FOXRED1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FOXRED1 antibody was raised against the N terminal of FOXRED1

Purification: Affinity purified

Immunogène: FOXRED1 antibody was raised using the N terminal of FOXRED1 corresponding to a region with amino acids SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FOXRED1 Blocking Peptide, catalog no. 33R-8389, is also available for use as a blocking control in assays to test for specificity of this FOXRED1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOXRED1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FOXRED1

Antigène: FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))

Autre désignation: FOXRED1 (FOXRED1 Produits)

Synonymes: anticorps H17, anticorps BC024806, anticorps TEG-23, anticorps Tex23, anticorps RGD1311785, anticorps FAD dependent oxidoreductase domain containing 1, anticorps FAD-dependent oxidoreductase domain containing 1, anticorps FOXRED1, anticorps Foxred1

Sujet: The FOXRED1 protein contains a FAD-dependent oxidoreductase domain. The encoded protein is localized to the mitochondria and may function as a chaperone protein required for the function of mitochondrial complex I. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene.

Poids moléculaire: 54 kDa (MW of target protein)