EIF4G2 anticorps (C-Term)

N° du produit ABIN633475

Détail du produit anti-EIF4G2 anticorps

Antigène: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4G2 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF4 G2 antibody was raised against the C terminal of EIF4 2

Purification: Affinity purified

Immunogène: EIF4 G2 antibody was raised using the C terminal of EIF4 2 corresponding to a region with amino acids KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4G2 Blocking Peptide, catalog no. 33R-4390, is also available for use as a blocking control in assays to test for specificity of this EIF4G2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4G2

Antigène: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Autre désignation: EIF4G2 (EIF4G2 Produits)

Synonymes: anticorps AAG1, anticorps DAP5, anticorps NAT1, anticorps P97, anticorps NAT1B, anticorps eif4g2, anticorps hm:zeh1307, anticorps wu:fa14h01, anticorps wu:fb44h01, anticorps wu:fb59c06, anticorps wu:fc21b05, anticorps EIF4G2, anticorps AA589388, anticorps DAP-5, anticorps E130105L11Rik, anticorps Nat1, anticorps Natm1, anticorps p97, anticorps NAT1A, anticorps im:7148615, anticorps wu:fb81f07, anticorps wu:fb82b06, anticorps wu:fb98h08, anticorps dap5, anticorps eif4g2.L, anticorps nat1, anticorps eukaryotic translation initiation factor 4 gamma 2, anticorps eukaryotic translation initiation factor 4, gamma 2b, anticorps eukaryotic translation initiation factor 4, gamma 2, anticorps eukaryotic translation initiation factor 4 gamma, 2, anticorps eIF4G-related protein NAT1, anticorps eukaryotic translation initiation factor 4, gamma 2a, anticorps eukaryotic translation initiation factor 4 gamma, 2 S homeolog, anticorps EIF4G2, anticorps eif4g2b, anticorps Eif4g2, anticorps nat1, anticorps eif4g2a, anticorps eif4g2.S

Sujet: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.

Poids moléculaire: 39 kDa (MW of target protein)