EIF4A2 anticorps (N-Term)

N° du produit ABIN633476

Détail du produit anti-EIF4A2 anticorps

Antigène: EIF4A2 (Eukaryotic Translation Initiation Factor 4A2 (EIF4A2))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF4 A2 antibody was raised against the N terminal of EIF4 2

Purification: Affinity purified

Immunogène: EIF4 A2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4A2 Blocking Peptide, catalog no. 33R-6430, is also available for use as a blocking control in assays to test for specificity of this EIF4A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4A2

Antigène: EIF4A2 (Eukaryotic Translation Initiation Factor 4A2 (EIF4A2))

Autre désignation: EIF4A2 (EIF4A2 Produits)

Synonymes: anticorps BM-010, anticorps DDX2B, anticorps EIF4A, anticorps EIF4F, anticorps eIF-4A-II, anticorps eIF4A-II, anticorps 4833432N07Rik, anticorps Ddx2b, anticorps Eif4, anticorps ddx2b, anticorps eif4aii, anticorps eif4f, anticorps xeif4aii, anticorps EIF4A2, anticorps EIF4AII, anticorps wu:fd50g11, anticorps zgc:63783, anticorps eukaryotic translation initiation factor 4A2, anticorps eukaryotic translation initiation factor 4A2 L homeolog, anticorps microRNA 1248, anticorps eukaryotic translation initiation factor 4A, isoform 2, anticorps Eif4a2, anticorps EIF4A2, anticorps eif4a2.L, anticorps eif4a2, anticorps MIR1248

Sujet: EIF4A2 contains 1 helicase C-terminal domain and 1 helicase ATP-binding domain. It belongs to the DEAD box helicase family. eIF4A subfamily. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5' untranslated region of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

Poids moléculaire: 45 kDa (MW of target protein)