RBM38 anticorps (N-Term)

N° du produit ABIN633487

Cet anticorps Lapin Polyclonal détecte spécifiquement RBM38 dans IHC et WB. Il présente une réactivité envers Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour RBM38 anticorps (N-Term) (ABIN633487)

Antigène: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM38 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Détail du produit anti-RBM38 anticorps

Épitope: N-Term

Specificité: RBM38 antibody was raised against the N terminal of RBM38

Purification: Affinity purified

Immunogène: RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM38 Blocking Peptide, (ABIN5615790), is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM38

Antigène: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Autre désignation: RBM38

Sujet: RBM38 is a probable RNA-binding protein.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development