RBM38 anticorps (N-Term)

N° du produit ABIN633487

Détail du produit anti-RBM38 anticorps

Antigène: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM38 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificité: RBM38 antibody was raised against the N terminal of RBM38

Purification: Affinity purified

Immunogène: RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM38 Blocking Peptide, catalog no. 33R-5295, is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM38

Antigène: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Autre désignation: RBM38 (RBM38 Produits)

Synonymes: anticorps rnpc1, anticorps seb4b, anticorps seb4d, anticorps XSeb4R, anticorps MGC89204, anticorps hsrnaseb, anticorps YF-55, anticorps fi25e12, anticorps wu:fi25e12, anticorps zgc:92336, anticorps xseb4r, anticorps HSRNASEB, anticorps RNPC1, anticorps SEB4B, anticorps SEB4D, anticorps dJ800J21.2, anticorps Rnpc1, anticorps Seb4, anticorps Seb4l, anticorps RNA binding motif protein 38, anticorps RNA binding motif protein 38 L homeolog, anticorps rbm38, anticorps rbm38.L, anticorps RBM38, anticorps Rbm38

Sujet: RBM38 is a probable RNA-binding protein.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development