KLHL23 anticorps

N° du produit ABIN633495

Cet anticorps anti-KLHL23 est un anticorps Lapin Polyclonal détectant KLHL23 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour KLHL23 anticorps (ABIN633495)

Antigène: KLHL23 (Kelch-Like 23 (KLHL23))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHL23 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KLHL23 anticorps

Purification: Affinity purified

Immunogène: KLHL23 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHL23 Blocking Peptide, (ABIN5614380), is also available for use as a blocking control in assays to test for specificity of this KLHL23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHL23

Antigène: KLHL23 (Kelch-Like 23 (KLHL23))

Autre désignation: KLHL23

Sujet: This protein mediates protein binding.

Poids moléculaire: 64 kDa (MW of target protein)