CELF5 anticorps (Middle Region)

N° du produit ABIN633503

Détail du produit anti-CELF5 anticorps

Antigène: CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CELF5 est non-conjugé

Application: Western Blotting (WB)

Specificité: BRUNOL5 antibody was raised against the middle region of BRUNOL5

Purification: Affinity purified

Immunogène: BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids GVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BRUNOL5 Blocking Peptide, catalog no. 33R-3659, is also available for use as a blocking control in assays to test for specificity of this BRUNOL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CELF5

Antigène: CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))

Autre désignation: BRUNOL5 (CELF5 Produits)

Synonymes: anticorps BRUNOL-5, anticorps BRUNOL5, anticorps CELF-5, anticorps 4930565A21Rik, anticorps Brunol5, anticorps RGD1565016, anticorps CUGBP Elav-like family member 5, anticorps CUGBP, Elav-like family member 5, anticorps CELF5, anticorps Celf5

Sujet: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.

Poids moléculaire: 52 kDa (MW of target protein)