CELF5 anticorps (Middle Region)
-
- Antigène Voir toutes CELF5 Anticorps
- CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CELF5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BRUNOL5 antibody was raised against the middle region of BRUNOL5
- Purification
- Affinity purified
- Immunogène
- BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP
- Top Product
- Discover our top product CELF5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BRUNOL5 Blocking Peptide, catalog no. 33R-1175, is also available for use as a blocking control in assays to test for specificity of this BRUNOL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))
- Autre désignation
- BRUNOL5 (CELF5 Produits)
- Synonymes
- anticorps BRUNOL-5, anticorps BRUNOL5, anticorps CELF-5, anticorps 4930565A21Rik, anticorps Brunol5, anticorps RGD1565016, anticorps CUGBP Elav-like family member 5, anticorps CUGBP, Elav-like family member 5, anticorps CELF5, anticorps Celf5
- Sujet
- Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.
- Poids moléculaire
- 52 kDa (MW of target protein)
-