PABPC1L2A anticorps

N° du produit ABIN633510

Cet anticorps anti-PABPC1L2A est un anticorps Lapin Polyclonal détectant PABPC1L2A dans WB. Adapté pour Humain.

Aperçu rapide pour PABPC1L2A anticorps (ABIN633510)

Antigène: PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PABPC1L2A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PABPC1L2A anticorps

Purification: Affinity purified

Immunogène: PABPC1 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PABPC1L2A Blocking Peptide, (ABIN5615184), is also available for use as a blocking control in assays to test for specificity of this PABPC1L2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PABPC1L2A

Antigène: PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))

Autre désignation: PABPC1L2A

Sujet: PABPC1L2A may be involved in nucleic acid and nucleotide binding

Poids moléculaire: 23 kDa (MW of target protein)