PABPC1L2A anticorps
-
- Antigène Tous les produits PABPC1L2A
- PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PABPC1L2A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PABPC1 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PABPC1L2A Blocking Peptide, catalog no. 33R-6710, is also available for use as a blocking control in assays to test for specificity of this PABPC1L2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))
- Autre désignation
- PABPC1L2A (PABPC1L2A Produits)
- Synonymes
- anticorps RBM32A, anticorps poly(A) binding protein cytoplasmic 1 like 2A, anticorps PABPC1L2A
- Sujet
- PABPC1L2A may be involved in nucleic acid and nucleotide binding
- Poids moléculaire
- 23 kDa (MW of target protein)
-