RBM34 anticorps (C-Term)

N° du produit ABIN633521

L’anticorps anti-RBM34 Polyclonal Lapin est utilisé pour la détection de RBM34 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour RBM34 anticorps (C-Term) (ABIN633521)

Antigène: RBM34 (RNA Binding Motif Protein 34 (RBM34))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM34 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RBM34 anticorps

Épitope: C-Term

Specificité: RBM34 antibody was raised against the C terminal of RBM34

Purification: Affinity purified

Immunogène: RBM34 antibody was raised using the C terminal of RBM34 corresponding to a region with amino acids SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM34 Blocking Peptide, (ABIN5615787), is also available for use as a blocking control in assays to test for specificity of this RBM34 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM34

Antigène: RBM34 (RNA Binding Motif Protein 34 (RBM34))

Autre désignation: RBM34

Sujet: RBM34 belongs to the RRM RBM34 family. It contains 2 RRM (RNA recognition motif) domains. The function of the RBM34 protein remains unknown.

Poids moléculaire: 48 kDa (MW of target protein)