TNRC6B anticorps (N-Term)

N° du produit ABIN633522

Cet anticorps anti-TNRC6B Polyclonal Lapin (ABIN633522) détecte spécifiquement TNRC6B dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TNRC6B anticorps (N-Term) (ABIN633522)

Antigène: TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNRC6B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TNRC6B anticorps

Épitope: N-Term

Specificité: TNRC6 B antibody was raised against the N terminal of TNRC6

Purification: Affinity purified

Immunogène: TNRC6 B antibody was raised using the N terminal of TNRC6 corresponding to a region with amino acids YVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TNRC6B Blocking Peptide, (ABIN936264), is also available for use as a blocking control in assays to test for specificity of this TNRC6B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNRC6B

Antigène: TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))

Autre désignation: TNRC6B

Sujet: TNRC6B is involved in the binding of RNA and nucleotides.

Poids moléculaire: 183 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway