CNOT6 anticorps (N-Term)

N° du produit ABIN633523

Cet anticorps Lapin Polyclonal détecte spécifiquement CNOT6 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour CNOT6 anticorps (N-Term) (ABIN633523)

Antigène: CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNOT6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CNOT6 anticorps

Épitope: N-Term

Specificité: CNOT6 antibody was raised against the N terminal of CNOT6

Purification: Affinity purified

Immunogène: CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNOT6 Blocking Peptide, (ABIN937872), is also available for use as a blocking control in assays to test for specificity of this CNOT6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNOT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNOT6

Antigène: CNOT6 (CCR4-NOT Transcription Complex, Subunit 6 (CNOT6))

Autre désignation: CNOT6

Sujet: CNOT6 is a subunit of the CCR4-NOT core transcriptional regulation complex. CNOT6 has a 3'-5' RNase activity and prefers polyadenylated substates.

Poids moléculaire: 63 kDa (MW of target protein)