CDKN2AIP anticorps (N-Term)

N° du produit ABIN633527

Détail du produit anti-CDKN2AIP anticorps

Antigène: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDKN2AIP est non-conjugé

Application: Western Blotting (WB)

Specificité: CDKN2 AIP antibody was raised against the N terminal of CDKN2 IP

Purification: Affinity purified

Immunogène: CDKN2 AIP antibody was raised using the N terminal of CDKN2 IP corresponding to a region with amino acids RRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWAN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDKN2AIP Blocking Peptide, catalog no. 33R-8130, is also available for use as a blocking control in assays to test for specificity of this CDKN2AIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKN0 IP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDKN2AIP

Antigène: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Autre désignation: CDKN2AIP (CDKN2AIP Produits)

Synonymes: anticorps CARF, anticorps 4921511I16Rik, anticorps AW208986, anticorps CDKN2AIP, anticorps RGD1305302, anticorps CDKN2A interacting protein, anticorps CDKN2A interacting protein L homeolog, anticorps CDKN2AIP, anticorps Cdkn2aip, anticorps cdkn2aip, anticorps cdkn2aip.L

Sujet: The CDKN2AIP protein activates TP53/p53 by CDKN2A-dependent and CDKN2A-independent pathways.

Poids moléculaire: 61 kDa (MW of target protein)