ADARB2 anticorps
-
- Antigène Voir toutes ADARB2 Anticorps
- ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADARB2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG
- Top Product
- Discover our top product ADARB2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADARB2 Blocking Peptide, ABIN5611942, is also available for use as a blocking control in assays to test for specificity of this ADARB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))
- Autre désignation
- ADARB2 (ADARB2 Produits)
- Synonymes
- anticorps Adar3, anticorps RED2, anticorps Red2, anticorps ADAR3, anticorps si:dkey-255g15.1, anticorps double-stranded RNA-specific editase B2, anticorps adenosine deaminase, RNA specific B2 (inactive), anticorps adenosine deaminase, RNA-specific, B2, anticorps adenosine deaminase, RNA-specific, B2 (non-functional), anticorps LOC722075, anticorps LOC742985, anticorps ADARB2, anticorps Adarb2, anticorps adarb2
- Sujet
- ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing.
- Poids moléculaire
- 80 kDa (MW of target protein)
-