Splicing Factor 4 anticorps (N-Term)

N° du produit ABIN633534

Cet anticorps anti-Splicing Factor 4 est un anticorps Lapin Polyclonal détectant Splicing Factor 4 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour Splicing Factor 4 anticorps (N-Term) (ABIN633534)

Antigène: Splicing Factor 4 (SF4)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Splicing Factor 4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Splicing Factor 4 anticorps

Épitope: N-Term

Specificité: SF4 antibody was raised against the N terminal of SF4

Purification: Affinity purified

Immunogène: SF4 antibody was raised using the N terminal of SF4 corresponding to a region with amino acids MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF4 Blocking Peptide, (ABIN5616093), is also available for use as a blocking control in assays to test for specificity of this SF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Splicing Factor 4

Antigène: Splicing Factor 4 (SF4)

Autre désignation: SF4

Sujet: SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.

Poids moléculaire: 72 kDa (MW of target protein)