ESRP2 anticorps (N-Term)

N° du produit ABIN633540

Cet anticorps anti-ESRP2 Polyclonal Lapin (ABIN633540) détecte spécifiquement ESRP2 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ESRP2 anticorps (N-Term) (ABIN633540)

Antigène: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ESRP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ESRP2 anticorps

Épitope: N-Term

Specificité: RBM35 B antibody was raised against the N terminal of RBM35

Purification: Affinity purified

Immunogène: RBM35 B antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM35B Blocking Peptide, (ABIN936934), is also available for use as a blocking control in assays to test for specificity of this RBM35B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ESRP2

Antigène: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Autre désignation: RBM35B

Sujet: RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing.

Poids moléculaire: 77 kDa (MW of target protein)