RPF1 anticorps (N-Term)

N° du produit ABIN633541

Cet anticorps Lapin Polyclonal détecte spécifiquement RPF1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour RPF1 anticorps (N-Term) (ABIN633541)

Antigène: RPF1 (Brix Domain Containing 5 (RPF1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPF1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPF1 anticorps

Épitope: N-Term

Specificité: BXDC5 antibody was raised against the N terminal of BXDC5

Purification: Affinity purified

Immunogène: BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BXDC5 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this BXDC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPF1

Antigène: RPF1 (Brix Domain Containing 5 (RPF1))

Autre désignation: BXDC5

Sujet: BXDC5 may be required for ribosome biogenesis.

Poids moléculaire: 38 kDa (MW of target protein)