RPF1 anticorps (N-Term)

N° du produit ABIN633541

Détail du produit anti-RPF1 anticorps

Antigène: RPF1 (Brix Domain Containing 5 (RPF1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: BXDC5 antibody was raised against the N terminal of BXDC5

Purification: Affinity purified

Immunogène: BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BXDC5 Blocking Peptide, catalog no. 33R-1004, is also available for use as a blocking control in assays to test for specificity of this BXDC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPF1

Antigène: RPF1 (Brix Domain Containing 5 (RPF1))

Autre désignation: BXDC5 (RPF1 Produits)

Synonymes: anticorps bxdc5, anticorps zgc:86604, anticorps MGC86358, anticorps BXDC5, anticorps MGC145697, anticorps RP11-118B23.1, anticorps 2210420E24Rik, anticorps 2310066N05Rik, anticorps Bxdc5, anticorps rpf1, anticorps ribosome production factor 1 homolog, anticorps ribosome production factor 1 homolog L homeolog, anticorps RNA processing factor 1, anticorps rpf1, anticorps RPF1, anticorps rpf1.L, anticorps Rpf1, anticorps bxdc5

Sujet: BXDC5 may be required for ribosome biogenesis.

Poids moléculaire: 38 kDa (MW of target protein)