C7orf64 anticorps (C-Term)

N° du produit ABIN633543

Détail du produit anti-C7orf64 anticorps

Antigène: C7orf64 (Chromosome 7 Open Reading Frame 64 (C7orf64))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C7orf64 est non-conjugé

Application: Western Blotting (WB)

Specificité: DKFZP564 O0523 antibody was raised against the C terminal of DKFZP564 0523

Purification: Affinity purified

Immunogène: DKFZP564 O0523 antibody was raised using the C terminal of DKFZP564 0523 corresponding to a region with amino acids FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DKFZP564O0523 Blocking Peptide, catalog no. 33R-2980, is also available for use as a blocking control in assays to test for specificity of this DKFZP564O0523 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP560 0523 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C7orf64

Antigène: C7orf64 (Chromosome 7 Open Reading Frame 64 (C7orf64))

Autre désignation: DKFZP564O0523 (C7orf64 Produits)

Synonymes: anticorps C7orf64, anticorps DKFZP564O0523, anticorps HSPC304, anticorps RGD1310794, anticorps AW548102, anticorps C030048B08Rik, anticorps dkfzp564o0523, anticorps C4H7orf64, anticorps RNA binding motif protein 48, anticorps rbm48, anticorps RBM48, anticorps Rbm48

Sujet: The function of DKFZP564O0523 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 42 kDa (MW of target protein)