LARP4 anticorps (Middle Region)

N° du produit ABIN633545

Détail du produit anti-LARP4 anticorps

Antigène: LARP4 (La Ribonucleoprotein Domain Family, Member 4 (LARP4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LARP4 est non-conjugé

Application: Western Blotting (WB)

Specificité: LARP4 antibody was raised against the middle region of LARP4

Purification: Affinity purified

Immunogène: LARP4 antibody was raised using the middle region of LARP4 corresponding to a region with amino acids VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LARP4 Blocking Peptide, catalog no. 33R-9818, is also available for use as a blocking control in assays to test for specificity of this LARP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LARP4

Antigène: LARP4 (La Ribonucleoprotein Domain Family, Member 4 (LARP4))

Autre désignation: LARP4 (LARP4 Produits)

Synonymes: anticorps C530046N12, anticorps D330037H05Rik, anticorps DXErtd793, anticorps DXErtd793e, anticorps La ribonucleoprotein domain family member 4, anticorps La ribonucleoprotein domain family, member 4, anticorps LARP4, anticorps larp4, anticorps Larp4

Sujet: The function of LARP4 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 72 kDa (MW of target protein)