RG9MTD3 anticorps
-
- Antigène Voir toutes RG9MTD3 Anticorps
- RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RG9MTD3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RG9 MTD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GEILATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPG
- Top Product
- Discover our top product RG9MTD3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RG9MTD3 Blocking Peptide, catalog no. 33R-3230, is also available for use as a blocking control in assays to test for specificity of this RG9MTD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))
- Autre désignation
- RG9MTD3 (RG9MTD3 Produits)
- Synonymes
- anticorps RG9MTD3, anticorps RP11-3J10.9, anticorps bA3J10.9, anticorps Rg9mtd3, anticorps 2610042J10Rik, anticorps Rnmtd3, anticorps tRNA methyltransferase 10B, anticorps TRMT10B, anticorps Trmt10b
- Sujet
- RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.
- Poids moléculaire
- 36 kDa (MW of target protein)
-