RALYL anticorps (C-Term)

N° du produit ABIN633555

Détail du produit anti-RALYL anticorps

Antigène: RALYL (RALY RNA Binding Protein-Like (RALYL))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RALYL est non-conjugé

Application: Western Blotting (WB)

Specificité: RALYL antibody was raised against the C terminal of RALYL

Purification: Affinity purified

Immunogène: RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RALYL Blocking Peptide, catalog no. 33R-1450, is also available for use as a blocking control in assays to test for specificity of this RALYL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALYL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RALYL

Antigène: RALYL (RALY RNA Binding Protein-Like (RALYL))

Autre désignation: RALYL (RALYL Produits)

Synonymes: anticorps RGD1305844, anticorps RALYL, anticorps LOC100225950, anticorps HNRPCL3, anticorps 0710005M24Rik, anticorps RALY RNA binding protein-like, anticorps RALY RNA binding protein like, anticorps RNA-binding Raly-like protein, anticorps Ralyl, anticorps RALYL, anticorps LOC100330501

Sujet: RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown.

Poids moléculaire: 32 kDa (MW of target protein)