NSUN6 anticorps (N-Term)

N° du produit ABIN633557

L’anticorps Lapin Polyclonal anti-NSUN6 a été validé pour WB. Il convient pour détecter NSUN6 dans des échantillons de Humain.

Aperçu rapide pour NSUN6 anticorps (N-Term) (ABIN633557)

Antigène: NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NSUN6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NSUN6 anticorps

Épitope: N-Term

Specificité: NSUN6 antibody was raised against the N terminal of NSUN6

Purification: Affinity purified

Immunogène: NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NSUN6 Blocking Peptide, (ABIN5615072), is also available for use as a blocking control in assays to test for specificity of this NSUN6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NSUN6

Antigène: NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))

Autre désignation: NSUN6

Sujet: NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.

Poids moléculaire: 52 kDa (MW of target protein)