Splicing Factor 1 anticorps (C-Term)

N° du produit ABIN633561

Cet anticorps anti-Splicing Factor 1 Polyclonal Lapin (ABIN633561) détecte spécifiquement Splicing Factor 1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Splicing Factor 1 anticorps (C-Term) (ABIN633561)

Antigène: Splicing Factor 1 (SF1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Splicing Factor 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Splicing Factor 1 anticorps

Épitope: C-Term

Specificité: SF1 antibody was raised against the C terminal of SF1

Purification: Affinity purified

Immunogène: SF1 antibody was raised using the C terminal of SF1 corresponding to a region with amino acids APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF1 Blocking Peptide, (ABIN936818), is also available for use as a blocking control in assays to test for specificity of this SF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Splicing Factor 1

Antigène: Splicing Factor 1 (SF1)

Autre désignation: SF1

Sujet: SF1 contains 1 CCHC-type zinc finger and 1 KH domain. SF1 is Necessary for the ATP-dependent first step of spliceosome assembly. It binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. SF1 may act as transcription repressor.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Ribonucleoprotein Complex Subunit Organization, Maintenance of Protein Location