SNRPA1 anticorps (Middle Region)

N° du produit ABIN633565

Détail du produit anti-SNRPA1 anticorps

Antigène: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SNRPA antibody was raised against the middle region of SNRPA

Purification: Affinity purified

Immunogène: SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPA Blocking Peptide, catalog no. 33R-6281, is also available for use as a blocking control in assays to test for specificity of this SNRPA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPA1

Antigène: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Autre désignation: SNRPA (SNRPA Produits)

Synonymes: anticorps Mud1, anticorps U1-A, anticorps U1A, anticorps im:7142962, anticorps zgc:101832, anticorps C430021M15Rik, anticorps Rnu1a-1, anticorps Rnu1a1, anticorps mud1, anticorps snf, anticorps fc19d01, anticorps wu:fc19d01, anticorps zgc:77810, anticorps T30B22.12, anticorps U1SNRNP-SPECIFIC PROTEIN, anticorps spliceosomal protein U1A, anticorps small nuclear ribonucleoprotein polypeptide A, anticorps small nuclear ribonucleoprotein polypeptide A', anticorps small nuclear ribonucleoprotein polypeptide A S homeolog, anticorps spliceosomal protein U1A, anticorps SNRPA, anticorps snrpa1, anticorps Snrpa, anticorps snrpa.S, anticorps snrpa, anticorps U1A

Sujet: SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.

Poids moléculaire: 31 kDa (MW of target protein)