SNRPA1 anticorps (Middle Region)

N° du produit ABIN633565

Cet anticorps Lapin Polyclonal détecte spécifiquement SNRPA1 dans WB et IHC. Il présente une réactivité avec des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour SNRPA1 anticorps (Middle Region) (ABIN633565)

Antigène: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SNRPA1 anticorps

Épitope: Middle Region

Specificité: SNRPA antibody was raised against the middle region of SNRPA

Purification: Affinity purified

Immunogène: SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPA Blocking Peptide, (ABIN5616322), is also available for use as a blocking control in assays to test for specificity of this SNRPA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPA1

Antigène: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Autre désignation: SNRPA

Sujet: SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.

Poids moléculaire: 31 kDa (MW of target protein)