DHX34 anticorps

N° du produit ABIN633572

Détail du produit anti-DHX34 anticorps

Antigène: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHX34 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DHX34 Blocking Peptide, catalog no. 33R-1434, is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DHX34

Antigène: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Autre désignation: DHX34 (DHX34 Produits)

Synonymes: anticorps DDX34, anticorps HRH1, anticorps 1200013B07Rik, anticorps 1810012L18Rik, anticorps Ddx34, anticorps mKIAA0134, anticorps DExH-box helicase 34, anticorps DEAH (Asp-Glu-Ala-His) box polypeptide 34, anticorps DEAH-box helicase 34, anticorps DHX34, anticorps dhx34, anticorps Dhx34

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.

Poids moléculaire: 128 kDa (MW of target protein)