BCAS2 anticorps (N-Term)

N° du produit ABIN633573

Cet anticorps anti-BCAS2 est un anticorps Lapin Polyclonal détectant BCAS2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour BCAS2 anticorps (N-Term) (ABIN633573)

Antigène: BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BCAS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BCAS2 anticorps

Épitope: N-Term

Specificité: BCAS2 antibody was raised against the N terminal of BCAS2

Purification: Affinity purified

Immunogène: BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BCAS2 Blocking Peptide, (ABIN5612290), is also available for use as a blocking control in assays to test for specificity of this BCAS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BCAS2

Antigène: BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))

Autre désignation: BCAS2

Sujet: BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function.

Poids moléculaire: 26 kDa (MW of target protein)