CARS anticorps (N-Term)

N° du produit ABIN633578

L’anticorps Lapin Polyclonal anti-CARS a été validé pour WB et IHC. Il convient pour détecter CARS dans des échantillons de Humain.

Aperçu rapide pour CARS anticorps (N-Term) (ABIN633578)

Antigène: CARS (Cysteinyl-tRNA Synthetase (CARS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CARS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CARS anticorps

Épitope: N-Term

Specificité: CARS antibody was raised against the N terminal of CARS

Purification: Affinity purified

Immunogène: CARS antibody was raised using the N terminal of CARS corresponding to a region with amino acids MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CARS Blocking Peptide, (ABIN5612626), is also available for use as a blocking control in assays to test for specificity of this CARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CARS

Antigène: CARS (Cysteinyl-tRNA Synthetase (CARS))

Autre désignation: CARS

Sujet: CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.

Poids moléculaire: 81 kDa (MW of target protein)